PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family GATA
Protein Properties Length: 288aa    MW: 31593.4 Da    PI: 8.9641
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542590.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.21.5e-20207241135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  XP_010542590.1 207 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 241
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.5E-19201251IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.163201237IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-15205264No hitNo description
Gene3DG3DSA:3.30.50.101.9E-15205238IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.50E-18206263No hitNo description
PROSITE patternPS003440207232IPR000679Zinc finger, GATA-type
PfamPF003202.4E-18207241IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MNNGSWLPEV DFQGVSDDFF DDLVNHLDFP LEDVGSGNGE GDWDAGFQGL EPPPMDMFSD  60
FNCGGINKGG GSIPILKQSS SSEASSVHQF SPSGVKVSKV FRSSSPVSVL ENTNVSFSSQ  120
NTRLAFPVKG VRSKRKRPTA LKLGLLLPPF EPTKSQQLPP EESEYEAVYY PSEKPGKKKS  180
KKNKIHPTHL DSANSEPKNS EGTVRKCTHC ETTKTPQWRE GPNGPKTLCN ACGVRFRSGR  240
LVPEYRPAAS PTFVPSVHSN SHRKIIEMRS KDGQKFDSGM IHTVISRA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542590.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_010542591.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-115GAT11_ARATH; GATA transcription factor 11
TrEMBLQ0WNS01e-113Q0WNS0_ARATH; Putative GATA transcription factor 3
STRINGAT1G08010.11e-112(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-108GATA transcription factor 11